dbPTM

SAS10_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SAS10_DROME
UniProt AC	Q9I7W5
Protein Name	Something about silencing protein 10
Gene Name	Sas10 {ECO:0000312\|EMBL:AAG22407.2}
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	428
Subcellular Localization	Nucleus .
Protein Description	Essential for gene silencing: has a role in the structure of silenced chromatin. May be involved in gene regulation during development. Binds RNA..
Protein Sequence	MDSDGDDYVMSGSDQEYDDEEREILEDLRKQRKKPHDPVQEVLGFSDDDDDDDDDDEEEQQDVAELMRDSDIEGAEDDDRDLPNTMDWGSKRSTYYNTDFVDQDYSSYNAQEEEQARAEEEEAKKIQLRLAKRMSEADFQLDNVEAAPAGSSDDNELSHITKVTSDLAGLSERERRQLMHSESPEFIILTQDFQQHLDEVKNLLKPVLNYVRKHDVPMVPALQYAGLCHTVLTTYCSNVAFYLLLKARRIDVKAHPVIRRLVQLKDLIEELKPRYEEYIRPQLEALLERIEDGDAFTVLDVAQRKAKLQILNKYNDGQQASVSSDDDDNDDDDDAESKEKDLQEEAGEEEEEEDARRGITYQMAKNKGLTPHRKKELRNPRVKHRGKYRKALIRRKGAVRTVRKELQRYGGELSGIKAGVTKSVKFRT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MDSDGDDYVM -----CCCCCCCCCC	42.04	19429919
8	Phosphorylation	MDSDGDDYVMSGSDQ CCCCCCCCCCCCCCC	11.64	19429919
11	Phosphorylation	DGDDYVMSGSDQEYD CCCCCCCCCCCCCCC	25.71	19429919
13	Phosphorylation	DDYVMSGSDQEYDDE CCCCCCCCCCCCCHH	28.90	19429919
46	Phosphorylation	VQEVLGFSDDDDDDD HHHHHCCCCCCCCCC	38.03	22817900
70	Phosphorylation	VAELMRDSDIEGAED HHHHHHHCCCCCCCC	30.07	19429919
135	Phosphorylation	LRLAKRMSEADFQLD HHHHHHHCCCCCCCC	33.40	22817900
151	Phosphorylation	VEAAPAGSSDDNELS CEECCCCCCCCCHHH	32.47	19429919
152	Phosphorylation	EAAPAGSSDDNELSH EECCCCCCCCCHHHH	48.33	19429919
158	Phosphorylation	SSDDNELSHITKVTS CCCCCHHHHHHHHHH	13.48	22668510
161	Phosphorylation	DNELSHITKVTSDLA CCHHHHHHHHHHHHC	17.65	19429919
165	Phosphorylation	SHITKVTSDLAGLSE HHHHHHHHHHCCCCH	33.35	22668510
314	Phosphorylation	KLQILNKYNDGQQAS HHHHHHHCCCCCCCC	19.88	19429919
321	Phosphorylation	YNDGQQASVSSDDDD CCCCCCCCCCCCCCC	20.42	19429919
323	Phosphorylation	DGQQASVSSDDDDND CCCCCCCCCCCCCCC	26.09	19429919
324	Phosphorylation	GQQASVSSDDDDNDD CCCCCCCCCCCCCCC	42.79	19429919
337	Phosphorylation	DDDDDAESKEKDLQE CCCCCHHHHHHHHHH	48.08	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SAS10_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SAS10_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SAS10_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SAS10_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SAS10_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-152; SER-323; SER-324AND SER-337, AND MASS SPECTROMETRY.	18327897 [Abstract]