dbPTM

SAP30_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SAP30_MOUSE
UniProt AC	O88574
Protein Name	Histone deacetylase complex subunit SAP30
Gene Name	Sap30 {ECO:0000312\|MGI:MGI:1929129}
Organism	Mus musculus (Mouse).
Sequence Length	220
Subcellular Localization	Nucleus.
Protein Description	Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones..
Protein Sequence	MNGFTPEEMSRGGDAAAAVAAVVAAAAAAASAGNGNAAGGGAEVPGAGAVSASGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFKSIPVNEKDTLTCFIYSVRNDKNKSDLKADSGVH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MNGFTPEEMSRG ---CCCCCHHHHCCC	31.05	-
131	Phosphorylation	NRRKRKGSDDDGGDS HHHHCCCCCCCCCCC	40.68	27087446
138	Phosphorylation	SDDDGGDSPVQDIDT CCCCCCCCCCCCCCC	30.19	27087446
145	Phosphorylation	SPVQDIDTPEVDLYQ CCCCCCCCCCEEEEH	22.98	21659605
151	Phosphorylation	DTPEVDLYQLQVNTL CCCCEEEEHHHHHHH	11.60	26643407

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SAP30_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SAP30_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SAP30_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SAP30_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SAP30_MOUSE

Related Literatures of Post-Translational Modification