SAM13_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAM13_HUMAN
• UniProt AC: Q5VXD3
• Protein Name: Sterile alpha motif domain-containing protein 13
• Gene Name: SAMD13
• Organism: Homo sapiens (Human).
• Sequence Length: 122
• Protein Sequence: MANSLLEGVFAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17 (in isoform 2)	Phosphorylation	-	7.37	22210691
33 (in isoform 3)	Phosphorylation	-	27.55	30206219
38 (in isoform 3)	Phosphorylation	-	44.15	30206219
41 (in isoform 3)	Phosphorylation	-	57.25	30206219
44 (in isoform 3)	Phosphorylation	-	51.68	30206219

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAM13_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAM13_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAM13_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SAM13_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.