UniProt ID | SAM13_HUMAN | |
---|---|---|
UniProt AC | Q5VXD3 | |
Protein Name | Sterile alpha motif domain-containing protein 13 | |
Gene Name | SAMD13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 122 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MANSLLEGVFAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 (in isoform 2) | Phosphorylation | - | 7.37 | 22210691 | |
33 (in isoform 3) | Phosphorylation | - | 27.55 | 30206219 | |
38 (in isoform 3) | Phosphorylation | - | 44.15 | 30206219 | |
41 (in isoform 3) | Phosphorylation | - | 57.25 | 30206219 | |
44 (in isoform 3) | Phosphorylation | - | 51.68 | 30206219 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAM13_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAM13_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAM13_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SAM13_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...