UniProt ID | SAC7_ARATH | |
---|---|---|
UniProt AC | Q9C5G5 | |
Protein Name | Phosphoinositide phosphatase SAC7 | |
Gene Name | SAC7 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 597 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Cytoplasmic vesicle membrane Multi-pass membrane protein . Associated to tip-localized membranes in growing root hairs (PubMed:18281508). |
|
Protein Description | Phosphoinositide phosphatase that preferentially hydrolyzes PtdIns(4)P. Regulates the accumulation of PtdIns(4)P on membrane compartments at the tips of growing root hairs leading to proper root hair development.. | |
Protein Sequence | METVDSRNKLHSRLRLWEFPDQYIIEPADGSGSSCLDISRVDASMKLIDQVPESNSVRVPKIRSIFGVVGMLKLLAGSYLVVVTESERVGSFLGHPIFKVTTLKVLPCDHSLKNSPEEQKKMETEFSKLLSVAEKTTGLYFSYEVNLTLSSQRLHEMGDESKSLPLWRQAEPRFLWNNYMLEVLIDNKLDQFLLPVIQGSFNSFETAIGRDIVDITLIARRCTRRNGTRMWRRGADLDGYVANFVETEQIVQMNGYTSSFVQVRGSMPFMWEQVVDLTYKPKFEIVQPEEAKRIAERHFLDLRKKYGSVLAVDLVNKQGGEGRLCEKYATVMQHITGDDIRYLHFDFHQICGHIHFERLSILYEQIEGFLEKNGYFLLNEKGEKMKEQLGVVRSNCIDCLDRTNVTQSMIGRKMLEVQLKRIGVFGAEETISSHLNFDEHYKILWANHGDEISIQYSGTPALKGDFVRYGHRTAHGVLKDGWSSLRRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGLEAVANFPVALFVVLMSFWFATMSLKQTGSDYKHKHLFFSLLWTGICVGMAALVRANGRIFCNRPRLHKPRG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
127 | Phosphorylation | KKMETEFSKLLSVAE HHHHHHHHHHHHHHH | 19880383 | ||
308 | Phosphorylation | DLRKKYGSVLAVDLV HHHHHHCCEEEEECC | 19880383 | ||
360 | Phosphorylation | HIHFERLSILYEQIE CCHHHHHHHHHHHHH | 19880383 | ||
403 | Phosphorylation | CIDCLDRTNVTQSMI HHHHHHHCCCCHHHH | 22074104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAC7_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAC7_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAC7_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SAC7_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...