dbPTM

SAAL1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SAAL1_MOUSE
UniProt AC	Q9D2C2
Protein Name	Protein SAAL1
Gene Name	Saal1
Organism	Mus musculus (Mouse).
Sequence Length	474
Subcellular Localization	Nucleus .
Protein Description	Plays a role in promoting the proliferation of synovial fibroblasts in response to proinflammatory stimuli..
Protein Sequence	MDRNPSPPPPTCGSEDEEDLGGGDRIGSTVYSKHWLFGVLSGLIQIVTPESGTSGSADEEEQADLAEEMENEICRVWDMSMDEDVALFLQEFKAPDIFMGVLAKSPCPRLREICVGILGNMACFREICESISKNEDHGQVLLQCLCDSDPPTLLETCRLLLTCLSQTEVASVWVRRIREHPSVYANVCFIMSSSTNVDLLVKVGEVVDKLFDLDEKLMLEWIRKGATRLPGQPHEDSEEQPVFSIVPCVLEAAKQVRSENLEGLDVYMRILQLLTTVDDGVQAIVQCPDTGNDTWRLLFDLVCHEFCQPDDPPVILQEQKTVLASVFSVLSAISASRAEQEHLKIEEGDLPLIDSLIRVLQNMEHCQKKPENPSESDTEEPTICGPTQDDFHMKILKDISCEFLSNIFQVLTKEKVAQGLKEGQLSKQKCSCAFQSLLPLYGPAVEDFVKVVREVDEALADDLEDSFPSVKAQT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MDRNPSPPPPTCG --CCCCCCCCCCCCC	54.29	25521595
11	Phosphorylation	NPSPPPPTCGSEDEE CCCCCCCCCCCCCCC	34.96	21082442
14	Phosphorylation	PPPPTCGSEDEEDLG CCCCCCCCCCCCCCC	43.98	25521595
28	Phosphorylation	GGGDRIGSTVYSKHW CCCCCCCCCHHHHHH	16.60	26160508
29	Phosphorylation	GGDRIGSTVYSKHWL CCCCCCCCHHHHHHH	20.46	26160508
31	Phosphorylation	DRIGSTVYSKHWLFG CCCCCCHHHHHHHHH	16.46	26160508
32	Phosphorylation	RIGSTVYSKHWLFGV CCCCCHHHHHHHHHH	17.44	26160508
157	S-palmitoylation	PPTLLETCRLLLTCL CCHHHHHHHHHHHHH	1.79	28680068
209	Ubiquitination	KVGEVVDKLFDLDEK HHHHHHHHHCCCCHH	39.17	-
374	Phosphorylation	QKKPENPSESDTEEP HCCCCCCCCCCCCCC	62.40	25521595
376	Phosphorylation	KPENPSESDTEEPTI CCCCCCCCCCCCCCC	54.92	25521595
378	Phosphorylation	ENPSESDTEEPTICG CCCCCCCCCCCCCCC	52.07	17525332
382	Phosphorylation	ESDTEEPTICGPTQD CCCCCCCCCCCCCCC	31.98	25619855
387	Phosphorylation	EPTICGPTQDDFHMK CCCCCCCCCCHHHHH	29.88	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SAAL1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SAAL1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SAAL1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SAAL1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SAAL1_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteomic analysis of the developing mouse brain."; Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.; Mol. Cell. Proteomics 3:1093-1101(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6 AND SER-14, AND MASSSPECTROMETRY.	15345747 [Abstract]
"ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage."; Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.; Science 316:1160-1166(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-378 AND THR-387, ANDMASS SPECTROMETRY.	17525332 [Abstract]