SAA2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAA2_HUMAN
• UniProt AC: P0DJI9
• Protein Name: Serum amyloid A-2 protein
• Gene Name: SAA2
• Organism: Homo sapiens (Human).
• Sequence Length: 122
• Subcellular Localization: Secreted.
• Protein Description: Major acute phase reactant. Apolipoprotein of the HDL complex..
• Protein Sequence: MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	VLSVSSRSFFSFLGE HHCCCCHHHHHHHHH	32.37	22210691
23	Phosphorylation	VSSRSFFSFLGEAFD CCCHHHHHHHHHHHH	19.97	22210691
47	Phosphorylation	SDMREANYIGSDKYF HHHHHHCCCCCCCCH	17.44	29083192
50	Phosphorylation	REANYIGSDKYFHAR HHHCCCCCCCCHHCC	22.75	29083192
52	2-Hydroxyisobutyrylation	ANYIGSDKYFHARGN HCCCCCCCCHHCCCC	52.06	-
53	Phosphorylation	NYIGSDKYFHARGNY CCCCCCCCHHCCCCH	12.94	-
64	2-Hydroxyisobutyrylation	RGNYDAAKRGPGGAW CCCHHHHHHCCCCHH	60.66	-
122	Phosphorylation	PAGLPEKY------- CCCCCCCC-------	23.33	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAA2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAA2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAA2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SAA2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.