UniProt ID | SAA1_HUMAN | |
---|---|---|
UniProt AC | P0DJI8 | |
Protein Name | Serum amyloid A-1 protein | |
Gene Name | SAA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 122 | |
Subcellular Localization | Secreted . | |
Protein Description | Major acute phase protein.. | |
Protein Sequence | MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Phosphorylation | CSLVLGVSSRSFFSF HHHHHCCCCHHHHHH | 20.45 | 29978859 | |
18 | Phosphorylation | SLVLGVSSRSFFSFL HHHHCCCCHHHHHHH | 29.54 | 28509920 | |
47 | Phosphorylation | SDMREANYIGSDKYF HHHHHHCCCCCCCCH | 17.44 | 29083192 | |
50 | Phosphorylation | REANYIGSDKYFHAR HHHCCCCCCCCHHCC | 22.75 | 29083192 | |
53 | Phosphorylation | NYIGSDKYFHARGNY CCCCCCCCHHCCCCH | 12.94 | - | |
77 | Phosphorylation | VWAAEAISDARENIQ CHHHHHHHHHHHHHH | 32.06 | - | |
94 | Phosphorylation | FGHGAEDSLADQAAN HCCCCHHHHHHHHHH | 19.57 | 27251275 | |
101 | "N4,N4-dimethylasparagine" | SLADQAANEWGRSGK HHHHHHHHHHHHCCC | 48.87 | - | |
101 | Methylation | SLADQAANEWGRSGK HHHHHHHHHHHHCCC | 48.87 | 8783012 | |
106 | Phosphorylation | AANEWGRSGKDPNHF HHHHHHHCCCCCCCC | 46.38 | 27251275 | |
122 | Phosphorylation | PAGLPEKY------- CCCCCCCC------- | 23.33 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SAA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SAA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SAA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SAA1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...