S5A1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S5A1_HUMAN
• UniProt AC: P18405
• Protein Name: 3-oxo-5-alpha-steroid 4-dehydrogenase 1
• Gene Name: SRD5A1
• Organism: Homo sapiens (Human).
• Sequence Length: 259
• Subcellular Localization: Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology..
• Protein Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MATATGVAEERL ---CCCCCCHHHHHH	28.03	30257219
230	Phosphorylation	FFTFCFLSGRAKEHH HHHHHHHHCCCHHHH	13.14	24719451
249	Ubiquitination	RKFEEYPKFRKIIIP HHHHHCHHHHHHHHH	57.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S5A1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S5A1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S5A1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACTBL_HUMAN	ACTBL2	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.