UniProt ID | S35G1_MOUSE | |
---|---|---|
UniProt AC | Q8BY79 | |
Protein Name | Solute carrier family 35 member G1 | |
Gene Name | Slc35g1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 368 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. Translocates from the endoplasmic reticulum to the cell membrane in response to a depletion of intracellular calcium and is detected at punctae c |
|
Protein Description | May play a role in intracellular calcium sensing and homeostasis. May act as a negative regulator of plasma membrane calcium-transporting ATPases preventing calcium efflux from the cell (By similarity).. | |
Protein Sequence | MGPPESAAELAAEAVELREPELQLADPASPGEEHVDVEAEGAPGRGRCWPCGAWACGSRGEPEAKKKAPCPGLGLFYTVLSAFLFSVASLFVKKVQGVHAVEISAFRCVVQMLVIIPCLIYRKTGFIGPKGQRLFLFLRGVFGSSAMILMYYAFQTTSLADATVIAFSCPVFTSIFAWIFLKEKYSLWDAFFTLFAIAGVILIVRPPFIFGSDTSGMRESYSEHIKGTFAAIGHAVLAAITLVILRKMGKSVDYFLSIWYYVILGLPEAIIILFVIGEWSLPYCGLDRLFLILIGLLGLGGQIFITKAVQIEKAGLVAIMKTMDIVFAFIFQIAFFDNVPTWWTVGGALCVVVSTTGATIRRWLQGSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of S35G1_MOUSE !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35G1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35G1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35G1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S35G1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...