| UniProt ID | S35G1_HUMAN | |
|---|---|---|
| UniProt AC | Q2M3R5 | |
| Protein Name | Solute carrier family 35 member G1 | |
| Gene Name | SLC35G1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 365 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . Translocates from the endoplasmic reticulum to the cell membrane in response to a depletion of intracellular calcium and is detected at punct |
|
| Protein Description | May play a role in intracellular calcium sensing and homeostasis. May act as a negative regulator of plasma membrane calcium-transporting ATPases preventing calcium efflux from the cell.. | |
| Protein Sequence | MRPQDSTGVAELQEPGLPLTDDAPPGATEEPAAAEAAGAPDRGRCWLCLSSPCCSRTEPEAKKKAPCPGLGLFYTLLSAFLFSVGSLFVKKVQDVHAVEISAFRCVFQMLVVIPCLIYRKTGFIGPKGQRIFLILRGVLGSTAMMLIYYAYQTMSLADATVITFSSPVFTSIFAWICLKEKYSPWDALFTVFTITGVILIVRPPFLFGSDTSGMEESYSGHLKGTFAAIGSAVFAASTLVILRKMGKSVDYFLSIWYYVVLGLVESVIILSVLGEWSLPYCGLDRLFLIFIGLFGLGGQIFITKALQIEKAGPVAIMKTMDVVFAFIFQIIFFNNVPTWWTVGGALCVVASNVGAAIRKWYQSSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 (in isoform 2) | Phosphorylation | - | 31.10 | 25627689 | |
| 51 | Phosphorylation | RCWLCLSSPCCSRTE CEEEEECCCCCCCCC | 14.70 | 21712546 | |
| 74 | Phosphorylation | CPGLGLFYTLLSAFL CCHHHHHHHHHHHHH | 11.08 | 27461979 | |
| 75 | Phosphorylation | PGLGLFYTLLSAFLF CHHHHHHHHHHHHHH | 17.56 | 27461979 | |
| 78 | Phosphorylation | GLFYTLLSAFLFSVG HHHHHHHHHHHHHHH | 21.78 | 27461979 | |
| 101 | Phosphorylation | DVHAVEISAFRCVFQ CCCCCHHHHHHHHHH | 14.09 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35G1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35G1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35G1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S35G1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
