| UniProt ID | S35E2_HUMAN | |
|---|---|---|
| UniProt AC | P0CK97 | |
| Protein Name | Solute carrier family 35 member E2 | |
| Gene Name | SLC35E2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 266 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Putative transporter.. | |
| Protein Sequence | MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGVWSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGRPSDREEREELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLPAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Ubiquitination | --MSSSVKTPALEEL --CCCCCCCHHHHHH | 51.22 | - | |
| 17 | Phosphorylation | LEELVPGSEEKPKGR HHHHCCCCCCCCCCC | 36.19 | 25159151 | |
| 20 | Ubiquitination | LVPGSEEKPKGRSPL HCCCCCCCCCCCCCC | 48.23 | 29967540 | |
| 22 | Ubiquitination | PGSEEKPKGRSPLSW CCCCCCCCCCCCCCH | 77.39 | 29967540 | |
| 25 | Phosphorylation | EEKPKGRSPLSWGSL CCCCCCCCCCCHHHH | 38.57 | 21712546 | |
| 28 | Phosphorylation | PKGRSPLSWGSLFGH CCCCCCCCHHHHCCC | 32.54 | 18669648 | |
| 31 | Phosphorylation | RSPLSWGSLFGHRSE CCCCCHHHHCCCCCC | 17.80 | 28857561 | |
| 39 | Ubiquitination | LFGHRSEKIVFAKSD HCCCCCCEEEEEECC | 45.47 | 29967540 | |
| 57 | Phosphorylation | DENVLTVTITETTVI CCCEEEEEEEECEEE | 19.56 | 24275569 | |
| 133 | Ubiquitination | PCCLYQHKARLSYPP HHHHHHHHHHHCCCC | 21.48 | - | |
| 145 | Phosphorylation | YPPNFLMTMLFVGLM CCCCHHHHHHHHHHH | 16.93 | 28387310 | |
| 163 | Phosphorylation | TVVLGLVSLKNVAVS HHHHHHHHHHHHHHH | 38.37 | 28387310 | |
| 170 | Phosphorylation | SLKNVAVSFAETVKS HHHHHHHHHHHHHHH | 14.70 | 29759185 | |
| 187 | Phosphorylation | PIFTVIMSRMILGEY CHHHHHHHHHHHHCC | 13.94 | 29759185 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35E2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35E2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35E2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S35E2_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
