| UniProt ID | S35D1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NTN3 | |
| Protein Name | UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter | |
| Gene Name | SLC35D1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 355 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Transports both UDP-glucuronic acid (UDP-GlcA) and UDP-N-acetylgalactosamine (UDP-GalNAc) from the cytoplasm into the endoplasmic reticulum lumen. [PubMed: 11322953] | |
| Protein Sequence | MAEVHRRQHARVKGEAPAKSSTLRDEEELGMASAETLTVFLKLLAAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYAFILINDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKAVEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLDIKGKGAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 97 | Acetylation | GKALRVVKFPDLDRN HHHHHEEECCCCCCC | 48.61 | 27452117 | |
| 116 | Phosphorylation | TFPLPLLYFGNQITG CCCCCEEECCCCEEC | 19.68 | - | |
| 222 | Phosphorylation | GKYGLLYYNALFMIL HHCHHHHHHHHHHHH | 8.23 | 28985074 | |
| 236 | Phosphorylation | LPTLAIAYFTGDAQK HHHHHHHHHHCCHHH | 8.78 | 28985074 | |
| 238 | Phosphorylation | TLAIAYFTGDAQKAV HHHHHHHHCCHHHHH | 22.83 | 28985074 | |
| 346 | Ubiquitination | KQSEANNKLDIKGKG HCCHHHCCCCCCCCC | 47.55 | 29967540 | |
| 350 | Ubiquitination | ANNKLDIKGKGAV-- HHCCCCCCCCCCC-- | 54.99 | 22505724 | |
| 377 | Ubiquitination | ----------------------------- ----------------------------- | 22505724 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35D1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35D1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35D1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S35D1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
