dbPTM

S35B4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S35B4_HUMAN
UniProt AC	Q969S0
Protein Name	UDP-xylose and UDP-N-acetylglucosamine transporter
Gene Name	SLC35B4
Organism	Homo sapiens (Human).
Sequence Length	331
Subcellular Localization	Golgi apparatus membrane Multi-pass membrane protein .
Protein Description	Sugar transporter that specifically mediates the transport of UDP-xylose (UDP-Xyl) and UDP-N-acetylglucosamine (UDP-GlcNAc) from cytosol into Golgi..
Protein Sequence	MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFKYTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIFQETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPVIGVTLPIMWFYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGTLFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
117	Phosphorylation	IILKKRYSIFKYTSI HHHHHCCCHHHHHHH	26.11	24719451
183	Phosphorylation	RMGIFQETLYKRFGK HHCHHHHHHHHHHCC	25.30	27251275
186	Ubiquitination	IFQETLYKRFGKHSK HHHHHHHHHHCCCCH	44.34	-
192	Phosphorylation	YKRFGKHSKEALFYN HHHHCCCCHHHHHCC	35.36	27251275
262	Phosphorylation	RGVFILTTECASLTV HCEEEEHHHHHHCCH	26.14	22210691
268	Phosphorylation	TTECASLTVTLVVTL HHHHHHCCHHHHHHH	14.67	22210691
274	Phosphorylation	LTVTLVVTLRKFVSL CCHHHHHHHHHHHHH	17.23	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S35B4_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of S35B4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S35B4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CR3L1_HUMAN	CREB3L1	physical	25416956

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S35B4_HUMAN

Related Literatures of Post-Translational Modification