dbPTM

S35A4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S35A4_HUMAN
UniProt AC	Q96G79
Protein Name	Probable UDP-sugar transporter protein SLC35A4 {ECO:0000305}
Gene Name	SLC35A4 {ECO:0000312\|HGNC:HGNC:20753}
Organism	Homo sapiens (Human).
Sequence Length	324
Subcellular Localization	Golgi apparatus membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLYYGSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
92	Phosphorylation	QAAPFALSALLYGAN HHHHHHHHHHHHCCC	17.28	24043423
96	Phosphorylation	FALSALLYGANNNLV HHHHHHHHCCCCCEE	18.29	24043423
105	Phosphorylation	ANNNLVIYLQRYMDP CCCCEEEEEHHCCCH	6.84	24043423
109	Phosphorylation	LVIYLQRYMDPSTYQ EEEEEHHCCCHHHHH	7.91	24043423
113	Phosphorylation	LQRYMDPSTYQVLSN EHHCCCHHHHHHHHC	35.17	24043423
114	Phosphorylation	QRYMDPSTYQVLSNL HHCCCHHHHHHHHCC	24.30	24043423
115	Phosphorylation	RYMDPSTYQVLSNLK HCCCHHHHHHHHCCC	10.85	24043423
119	Phosphorylation	PSTYQVLSNLKIGST HHHHHHHHCCCCCHH	41.06	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S35A4_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of S35A4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S35A4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of S35A4_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S35A4_HUMAN

Related Literatures of Post-Translational Modification