UniProt ID | S35A4_HUMAN | |
---|---|---|
UniProt AC | Q96G79 | |
Protein Name | Probable UDP-sugar transporter protein SLC35A4 {ECO:0000305} | |
Gene Name | SLC35A4 {ECO:0000312|HGNC:HGNC:20753} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 324 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MSVEDGGMPGLGRPRQARWTLMLLLSTAMYGAHAPLLALCHVDGRVPFRPSSAVLLTELTKLLLCAFSLLVGWQAWPQGPPPWRQAAPFALSALLYGANNNLVIYLQRYMDPSTYQVLSNLKIGSTAVLYCLCLRHRLSVRQGLALLLLMAAGACYAAGGLQVPGNTLPSPPPAAAASPMPLHITPLGLLLLILYCLISGLSSVYTELLMKRQRLPLALQNLFLYTFGVLLNLGLHAGGGSGPGLLEGFSGWAALVVLSQALNGLLMSAVMKHGSSITRLFVVSCSLVVNAVLSAVLLRLQLTAAFFLATLLIGLAMRLYYGSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | Phosphorylation | QAAPFALSALLYGAN HHHHHHHHHHHHCCC | 17.28 | 24043423 | |
96 | Phosphorylation | FALSALLYGANNNLV HHHHHHHHCCCCCEE | 18.29 | 24043423 | |
105 | Phosphorylation | ANNNLVIYLQRYMDP CCCCEEEEEHHCCCH | 6.84 | 24043423 | |
109 | Phosphorylation | LVIYLQRYMDPSTYQ EEEEEHHCCCHHHHH | 7.91 | 24043423 | |
113 | Phosphorylation | LQRYMDPSTYQVLSN EHHCCCHHHHHHHHC | 35.17 | 24043423 | |
114 | Phosphorylation | QRYMDPSTYQVLSNL HHCCCHHHHHHHHCC | 24.30 | 24043423 | |
115 | Phosphorylation | RYMDPSTYQVLSNLK HCCCHHHHHHHHCCC | 10.85 | 24043423 | |
119 | Phosphorylation | PSTYQVLSNLKIGST HHHHHHHHCCCCCHH | 41.06 | 24043423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35A4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35A4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35A4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S35A4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...