S2553_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S2553_HUMAN
• UniProt AC: Q5H9E4
• Protein Name: Solute carrier family 25 member 53
• Gene Name: SLC25A53
• Organism: Homo sapiens (Human).
• Sequence Length: 307
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Sequence: MGEQNHSPGKELQHRTRAEAPGKKSWHSQAYALGAVSNFMSTFLTFPIYKVVFRQQIHAMAVSEAVRQLWHEGPQYFYRGIYPPLLSKTLQGTLLFGTYDSLLCFLSPVGPHTLGHRWAAGLMSGVVEAVALSPFERVQNVLQDGRKQARFPSTFSILKEFNSYGLWGRLSLGYYRGFWPVLARNSLGSALYFSFKDPIQDGLAEQGLPHWVPALVSGSVNGTITCLVLYPLIVLVANMQSHIGWQNMPSLWASAQDVWNTRGRKLLLIYRGGSLVILRSSVTWGLTTAIHDFLQRKSHSRKELKTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
156	Phosphorylation	ARFPSTFSILKEFNS HCCCCHHHHHHHHHH	27.40	24719451
194	O-linked_Glycosylation	LGSALYFSFKDPIQD CCCEEEEECCCCCCC	20.17	30620550
194	Phosphorylation	LGSALYFSFKDPIQD CCCEEEEECCCCCCC	20.17	24719451
274	Phosphorylation	LLIYRGGSLVILRSS EEEEECCEEEEEECC	23.45	23532336

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S2553_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S2553_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S2553_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of S2553_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.