dbPTM

S2545_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S2545_MOUSE
UniProt AC	Q8CFJ7
Protein Name	Solute carrier family 25 member 45
Gene Name	Slc25a45
Organism	Mus musculus (Mouse).
Sequence Length	288
Subcellular Localization	Mitochondrion inner membrane Multi-pass membrane protein.
Protein Description
Protein Sequence	MPVEEFVAGWISGAVGLVLGHPFDTVKVRLQTQSTYQGIVDCVVKTYRHESVLGFFKGMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFDLIKVRLQNQTEPRMQISSSMPRYRGPVHCAASILREEGPQGLFRGSWALVLRDTPTLGMYFVTYEGLCRQYTPEGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASSFRQEGIGVFFKGMTLNSARAFPVNAATFLSYEYLLRLWR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
239	Phosphorylation	DGLKGRKYGGMLDCM CCCCCCCCCHHHHHH	19.97	28576409
245	S-palmitoylation	KYGGMLDCMASSFRQ CCCHHHHHHHHHHHH	1.85	28526873

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S2545_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of S2545_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S2545_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of S2545_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S2545_MOUSE

Related Literatures of Post-Translational Modification