UniProt ID | S2544_HUMAN | |
---|---|---|
UniProt AC | Q96H78 | |
Protein Name | Solute carrier family 25 member 44 | |
Gene Name | SLC25A44 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 314 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | ||
Protein Sequence | MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSYLCPKECPHIVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRHW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
183 | Phosphorylation | ADGLRGFYRGYVASL HCCCCHHHHHHHHHH | 13.12 | - | |
298 | Phosphorylation | VIVVGYESLKKLSLR EEEECHHHHHHHCCC | 36.68 | - | |
303 | Phosphorylation | YESLKKLSLRPELVD HHHHHHHCCCHHHHC | 31.08 | 24719451 | |
311 | Phosphorylation | LRPELVDSRHW---- CCHHHHCCCCC---- | 20.68 | 24719451 | |
319 | Phosphorylation | RHW------------ CCC------------ | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S2544_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S2544_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S2544_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IMDH2_HUMAN | IMPDH2 | physical | 26186194 | |
LASP1_HUMAN | LASP1 | physical | 26186194 | |
IMDH2_HUMAN | IMPDH2 | physical | 28514442 | |
LASP1_HUMAN | LASP1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...