UniProt ID | S22A2_HUMAN | |
---|---|---|
UniProt AC | O15244 | |
Protein Name | Solute carrier family 22 member 2 | |
Gene Name | SLC22A2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 555 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Mediates tubular uptake of organic compounds from circulation. Mediates the influx of agmatine, dopamine, noradrenaline (norepinephrine), serotonin, choline, famotidine, ranitidine, histamin, creatinine, amantadine, memantine, acriflavine, 4-[4-(dimethylamino)-styryl]-N-methylpyridinium ASP, amiloride, metformin, N-1-methylnicotinamide (NMN), tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, cisplatin and oxaliplatin. Cisplatin may develop a nephrotoxic action. Transport of creatinine is inhibited by fluoroquinolones such as DX-619 and LVFX. This transporter is a major determinant of the anticancer activity of oxaliplatin and may contribute to antitumor specificity.. | |
Protein Sequence | MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | Phosphorylation | SPGVAELSLRCGWSP CCCCEEEEEECCCCC | 12.79 | 24719451 | |
72 | N-linked_Glycosylation | WSPAEELNYTVPGPG CCCHHHCCCCCCCCC | 33.44 | UniProtKB CARBOHYD | |
236 | Phosphorylation | VGRRYRRTVGIFYQV HCHHHHHHHHHHHHH | 17.68 | - | |
241 | Phosphorylation | RRTVGIFYQVAYTVG HHHHHHHHHHHHHHH | 10.52 | - | |
313 | Phosphorylation | IAKKNGKSLPASLQR HHHHCCCCCCHHHHH | 40.77 | 27174698 | |
317 | Phosphorylation | NGKSLPASLQRLRLE CCCCCCHHHHHHHHH | 24.09 | 27174698 | |
471 | Phosphorylation | NLGVHICSSMCDIGG HHCHHHHHHCCCCCC | 22.09 | - | |
489 | Phosphorylation | PFLVYRLTNIWLELP HHHHHHHHCHHHHHH | 18.69 | - | |
517 | Phosphorylation | LVLLLPETKGKALPE EEHCCCCCCCCCCCH | 43.06 | - | |
544 | Phosphorylation | KNKEKMIYLQVQKLD CCHHCEEEEEEEECC | 6.38 | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S22A2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S22A2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S22A2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SUMO2_HUMAN | SUMO2 | physical | 21988832 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...