S1PR1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S1PR1_MOUSE
• UniProt AC: O08530
• Protein Name: Sphingosine 1-phosphate receptor 1
• Gene Name: S1pr1
• Organism: Mus musculus (Mouse).
• Sequence Length: 382
• Subcellular Localization: Cell membrane; Multi-pass membrane protein. Endosome. Membrane, caveola. Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor inte
• Protein Description: G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury..
• Protein Sequence: MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MVSTSIPEV ------CCCCCHHHH	9.57	23806337
10	Acetylation	STSIPEVKALRSSVS CCCHHHHHHHHHHCH	39.79	23806337
19	Nitration	LRSSVSDYGNYDIIV HHHHCHHHCCEEEEE	10.36	-
30	N-linked_Glycosylation	DIIVRHYNYTGKLNI EEEEEEEECCCCCCC	23.05	-
145	Phosphorylation	IAIERYITMLKMKLH HHHHHHHHHHHHHCC	13.91	28059163
158	Phosphorylation	LHNGSNSSRSFLLIS CCCCCCCCHHHHHHH	35.87	28059163
226	Phosphorylation	ILYCRIYSLVRTRSR HHHHHHHHHHHHHHH	20.30	28973931
236	Phosphorylation	RTRSRRLTFRKNISK HHHHHHHHHHHHHHH	21.41	23140645
291	Phosphorylation	AKTCDILYKAEYFLV CCCCHHHHHHHHHHH	14.42	25619855
328	S-palmitoylation	AFIRIVSCCKCPNGD HHHHHHHCCCCCCCC	1.46	28680068
329	S-palmitoylation	FIRIVSCCKCPNGDS HHHHHHCCCCCCCCC	3.86	28680068
331	S-palmitoylation	RIVSCCKCPNGDSAG HHHHCCCCCCCCCCC	1.65	28680068
341	Ubiquitination	GDSAGKFKRPIIPGM CCCCCCCCCCCCCCC	61.83	22790023
351	Phosphorylation	IIPGMEFSRSKSDNS CCCCCCCCCCCCCCC	23.49	25521595
353	Phosphorylation	PGMEFSRSKSDNSSH CCCCCCCCCCCCCCC	35.00	27180971
355	Phosphorylation	MEFSRSKSDNSSHPQ CCCCCCCCCCCCCCC	43.18	29899451
358	Phosphorylation	SRSKSDNSSHPQKDD CCCCCCCCCCCCCCC	34.71	29899451
359	Phosphorylation	RSKSDNSSHPQKDDG CCCCCCCCCCCCCCC	45.50	26160508
371	Phosphorylation	DDGDNPETIMSSGNV CCCCCHHHHHCCCCC	24.20	23140645
374	Phosphorylation	DNPETIMSSGNVNSS CCHHHHHCCCCCCCC	31.10	23140645
375	Phosphorylation	NPETIMSSGNVNSSS CHHHHHCCCCCCCCC	19.60	23140645
380	Phosphorylation	MSSGNVNSSS----- HCCCCCCCCC-----	27.89	23140645
381	Phosphorylation	SSGNVNSSS------ CCCCCCCCC------	34.56	23140645
382	Phosphorylation	SGNVNSSS------- CCCCCCCC-------	44.02	23140645

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S1PR1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S1PR1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S1PR1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
JAK2_MOUSE	Jak2	physical	21102457

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.