| UniProt ID | S1A7A_HUMAN | |
|---|---|---|
| UniProt AC | Q86SG5 | |
| Protein Name | Protein S100-A7A | |
| Gene Name | S100A7A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 101 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.. | |
| Protein Sequence | MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSNTQAERS ------CCCHHHHHH | 48.89 | - | |
| 2 | Phosphorylation | ------MSNTQAERS ------CCCHHHHHH | 48.89 | 21406692 | |
| 4 | Phosphorylation | ----MSNTQAERSII ----CCCHHHHHHHH | 23.11 | 21406692 | |
| 9 | Phosphorylation | SNTQAERSIIGMIDM CCHHHHHHHHHHHHH | 15.29 | 21406692 | |
| 31 | Phosphorylation | DGKIEKPSLLTMMKE CCCCCCCHHHHHHHH | 47.26 | 20068231 | |
| 34 | Phosphorylation | IEKPSLLTMMKENFP CCCCHHHHHHHHHCC | 22.10 | 20068231 | |
| 45 | Phosphorylation | ENFPNFLSACDKKGI HHCCCHHHHCCCCCC | 23.78 | 23663014 | |
| 90 | Phosphorylation | AADYHKQSHGAAPCS HHHHHHHHCCCCCCC | 28.79 | 23090842 | |
| 97 | Phosphorylation | SHGAAPCSGGSQ--- HCCCCCCCCCCC--- | 45.17 | 23090842 | |
| 100 | Phosphorylation | AAPCSGGSQ------ CCCCCCCCC------ | 35.92 | 22617229 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S1A7A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S1A7A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S1A7A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S1A7A_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
