UniProt ID | S1A7A_HUMAN | |
---|---|---|
UniProt AC | Q86SG5 | |
Protein Name | Protein S100-A7A | |
Gene Name | S100A7A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.. | |
Protein Sequence | MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSNTQAERS ------CCCHHHHHH | 48.89 | - | |
2 | Phosphorylation | ------MSNTQAERS ------CCCHHHHHH | 48.89 | 21406692 | |
4 | Phosphorylation | ----MSNTQAERSII ----CCCHHHHHHHH | 23.11 | 21406692 | |
9 | Phosphorylation | SNTQAERSIIGMIDM CCHHHHHHHHHHHHH | 15.29 | 21406692 | |
31 | Phosphorylation | DGKIEKPSLLTMMKE CCCCCCCHHHHHHHH | 47.26 | 20068231 | |
34 | Phosphorylation | IEKPSLLTMMKENFP CCCCHHHHHHHHHCC | 22.10 | 20068231 | |
45 | Phosphorylation | ENFPNFLSACDKKGI HHCCCHHHHCCCCCC | 23.78 | 23663014 | |
90 | Phosphorylation | AADYHKQSHGAAPCS HHHHHHHHCCCCCCC | 28.79 | 23090842 | |
97 | Phosphorylation | SHGAAPCSGGSQ--- HCCCCCCCCCCC--- | 45.17 | 23090842 | |
100 | Phosphorylation | AAPCSGGSQ------ CCCCCCCCC------ | 35.92 | 22617229 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S1A7A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S1A7A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S1A7A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S1A7A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...