dbPTM

S17P_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S17P_ARATH
UniProt AC	P46283
Protein Name	Sedoheptulose-1,7-bisphosphatase, chloroplastic
Gene Name	At3g55800
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	393
Subcellular Localization	Plastid, chloroplast.
Protein Description
Protein Sequence	METSIACYSRGILPPSVSSQRSSTLVSPPSYSTSSSFKRLKSSSIFGDSLRLAPKSQLKATKAKSNGASTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDPLDGSSIVDTNFTVGTIFGVWPGDKLTGITGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEFLLLDEGKWQHVKETTEIAEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGHKSVLDKTIINLDDRTQVAYGSKNEIIRFEETLYGTSRLKNVPIGVTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	PSYSTSSSFKRLKSS CCCCCCHHHCHHHHC	34.26	26091701
273	Phosphorylation	LRATFDNSEYSKLID EEEEECCHHHHHHHH	39.49	30291188
288	Phosphorylation	YYVKEKYTLRYTGGM HHHCCCEEEEECCCC	18.81	29654922
291	Phosphorylation	KEKYTLRYTGGMVPD CCCEEEEECCCCCCC	16.92	25561503
292	Phosphorylation	EKYTLRYTGGMVPDV CCEEEEECCCCCCCH	22.33	23111157
353	Phosphorylation	HKSVLDKTIINLDDR CHHHCCCEEEECCCC	27.10	30291188
381	Phosphorylation	FEETLYGTSRLKNVP EEEEHHCCCCCCCCC	9.34	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S17P_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of S17P_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S17P_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of S17P_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S17P_ARATH

Related Literatures of Post-Translational Modification