UniProt ID | S17P_ARATH | |
---|---|---|
UniProt AC | P46283 | |
Protein Name | Sedoheptulose-1,7-bisphosphatase, chloroplastic | |
Gene Name | At3g55800 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 393 | |
Subcellular Localization | Plastid, chloroplast. | |
Protein Description | ||
Protein Sequence | METSIACYSRGILPPSVSSQRSSTLVSPPSYSTSSSFKRLKSSSIFGDSLRLAPKSQLKATKAKSNGASTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTACVNSFGDEQLAVDMLADKLLFEALQYSHVCKYACSEEVPELQDMGGPVEGGFSVAFDPLDGSSIVDTNFTVGTIFGVWPGDKLTGITGGDQVAAAMGIYGPRTTYVLAVKGFPGTHEFLLLDEGKWQHVKETTEIAEGKMFSPGNLRATFDNSEYSKLIDYYVKEKYTLRYTGGMVPDVNQIIVKEKGIFTNVTSPTAKAKLRLLFEVAPLGLLIENAGGFSSDGHKSVLDKTIINLDDRTQVAYGSKNEIIRFEETLYGTSRLKNVPIGVTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | PSYSTSSSFKRLKSS CCCCCCHHHCHHHHC | 34.26 | 26091701 | |
273 | Phosphorylation | LRATFDNSEYSKLID EEEEECCHHHHHHHH | 39.49 | 30291188 | |
288 | Phosphorylation | YYVKEKYTLRYTGGM HHHCCCEEEEECCCC | 18.81 | 29654922 | |
291 | Phosphorylation | KEKYTLRYTGGMVPD CCCEEEEECCCCCCC | 16.92 | 25561503 | |
292 | Phosphorylation | EKYTLRYTGGMVPDV CCEEEEECCCCCCCH | 22.33 | 23111157 | |
353 | Phosphorylation | HKSVLDKTIINLDDR CHHHCCCEEEECCCC | 27.10 | 30291188 | |
381 | Phosphorylation | FEETLYGTSRLKNVP EEEEHHCCCCCCCCC | 9.34 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S17P_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S17P_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S17P_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S17P_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...