| UniProt ID | S14L2_HUMAN | |
|---|---|---|
| UniProt AC | O76054 | |
| Protein Name | SEC14-like protein 2 | |
| Gene Name | SEC14L2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 403 | |
| Subcellular Localization | Cytoplasm. Nucleus. Cytoplasmic in absence of alpha-tocopherol, and nuclear in presence of alpha-tocopherol. | |
| Protein Description | Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell.. | |
| Protein Sequence | MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | SGRVGDLSPRQKEAL CCCCCCCCHHHHHHH | 23.83 | 29255136 | |
| 36 | Phosphorylation | ALPNPDDYFLLRWLR CCCCHHHHHHHHHHH | 11.96 | 24275569 | |
| 46 | Phosphorylation | LRWLRARSFDLQKSE HHHHHHHCCCCHHHH | 23.33 | 28258704 | |
| 51 | Succinylation | ARSFDLQKSEAMLRK HHCCCCHHHHHHHHH | 58.52 | - | |
| 51 | Succinylation | ARSFDLQKSEAMLRK HHCCCCHHHHHHHHH | 58.52 | - | |
| 113 | Ubiquitination | LDAKGLLFSASKQDL CCHHCCCCCCCHHHH | 7.43 | 21890473 | |
| 114 | Phosphorylation | DAKGLLFSASKQDLL CHHCCCCCCCHHHHH | 31.44 | 24719451 | |
| 116 | Phosphorylation | KGLLFSASKQDLLRT HCCCCCCCHHHHHHH | 29.65 | 28348404 | |
| 117 | Ubiquitination | GLLFSASKQDLLRTK CCCCCCCHHHHHHHH | 47.77 | - | |
| 171 | Phosphorylation | WKPAVEAYGEFLCMF CHHHHHHHHHHHHHH | 12.04 | 25072903 | |
| 182 | Phosphorylation | LCMFEENYPETLKRL HHHHCCCCHHHHHHH | 13.01 | 25072903 | |
| 185 | Phosphorylation | FEENYPETLKRLFVV HCCCCHHHHHHHEEE | 32.83 | 25072903 | |
| 196 | Ubiquitination | LFVVKAPKLFPVAYN HEEEECCCHHHHHHH | 68.56 | 21890473 | |
| 196 | Ubiquitination | LFVVKAPKLFPVAYN HEEEECCCHHHHHHH | 68.56 | 21890473 | |
| 225 | Ubiquitination | MVLGANWKEVLLKHI EEECCCHHHHHHHHC | 37.44 | - | |
| 230 | Ubiquitination | NWKEVLLKHISPDQV CHHHHHHHHCCCCCC | 34.43 | - | |
| 241 | Phosphorylation | PDQVPVEYGGTMTDP CCCCCCEECCEEECC | 22.53 | - | |
| 253 | Succinylation | TDPDGNPKCKSKINY ECCCCCCCCCCCCCC | 59.29 | - | |
| 253 | Succinylation | TDPDGNPKCKSKINY ECCCCCCCCCCCCCC | 59.29 | - | |
| 255 | Ubiquitination | PDGNPKCKSKINYGG CCCCCCCCCCCCCCC | 61.99 | - | |
| 257 | Succinylation | GNPKCKSKINYGGDI CCCCCCCCCCCCCCC | 22.07 | - | |
| 257 | Succinylation | GNPKCKSKINYGGDI CCCCCCCCCCCCCCC | 22.07 | - | |
| 260 | Phosphorylation | KCKSKINYGGDIPRK CCCCCCCCCCCCCCE | 26.42 | - | |
| 268 | Phosphorylation | GGDIPRKYYVRDQVK CCCCCCEEEEHHHHH | 14.42 | - | |
| 278 | Phosphorylation | RDQVKQQYEHSVQIS HHHHHHHEEEEEEEE | 17.08 | 24043423 | |
| 281 | Phosphorylation | VKQQYEHSVQISRGS HHHHEEEEEEEECCC | 12.08 | 28857561 | |
| 285 | Phosphorylation | YEHSVQISRGSSHQV EEEEEEEECCCCCEE | 17.31 | 24043423 | |
| 288 | Phosphorylation | SVQISRGSSHQVEYE EEEEECCCCCEEEEE | 24.44 | 27251275 | |
| 289 | Phosphorylation | VQISRGSSHQVEYEI EEEECCCCCEEEEEE | 22.29 | 22817900 | |
| 294 | Phosphorylation | GSSHQVEYEILFPGC CCCCEEEEEEECCCC | 14.93 | - | |
| 333 | Sulfoxidation | ERQRAGEMTEVLPNQ CCHHHCCCEECCCCC | 3.66 | 21406390 | |
| 361 | Phosphorylation | TCSDPGIYVLRFDNT EECCCCEEEEEECCE | 10.19 | - | |
| 369 | Phosphorylation | VLRFDNTYSFIHAKK EEEECCEEEEEEEEE | 14.08 | - | |
| 393 | Succinylation | PDKASEEKMKQLGAG CCCCCHHHHHHCCCC | 47.55 | - | |
| 393 | Succinylation | PDKASEEKMKQLGAG CCCCCHHHHHHCCCC | 47.55 | - | |
| 395 | Ubiquitination | KASEEKMKQLGAGTP CCCHHHHHHCCCCCC | 54.13 | - | |
| 401 | Phosphorylation | MKQLGAGTPK----- HHHCCCCCCC----- | 27.63 | 28857561 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 289 | S | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S14L2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S14L2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S14L2_HUMAN !! | ||||
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00163 | Vitamin E |
loading...