| UniProt ID | S10A6_RAT | |
|---|---|---|
| UniProt AC | P05964 | |
| Protein Name | Protein S100-A6 | |
| Gene Name | S100a6 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 89 | |
| Subcellular Localization |
Nucleus envelope. Cytoplasm. Cell membrane Peripheral membrane protein Cytoplasmic side. |
|
| Protein Description | May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative (By similarity).. | |
| Protein Sequence | MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGAKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Acetylation | IFHKYSGKEGDKHTL HHHHHCCCCCCCCCC | 53.21 | 22902405 | |
| 26 | Acetylation | YSGKEGDKHTLSKKE HCCCCCCCCCCCHHH | 49.71 | 22902405 | |
| 35 | Acetylation | TLSKKELKELIQKEL CCCHHHHHHHHHHHC | 52.12 | 22902405 | |
| 40 | Acetylation | ELKELIQKELTIGAK HHHHHHHHHCHHCHH | 47.93 | 22902405 | |
| 47 | Acetylation | KELTIGAKLQDAEIA HHCHHCHHHCHHHHH | 41.28 | 22902405 | |
| 47 | Succinylation | KELTIGAKLQDAEIA HHCHHCHHHCHHHHH | 41.28 | - | |
| 47 | Succinylation | KELTIGAKLQDAEIA HHCHHCHHHCHHHHH | 41.28 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10A6_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10A6_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A6_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S10A6_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
