UniProt ID | S10A6_RAT | |
---|---|---|
UniProt AC | P05964 | |
Protein Name | Protein S100-A6 | |
Gene Name | S100a6 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 89 | |
Subcellular Localization |
Nucleus envelope. Cytoplasm. Cell membrane Peripheral membrane protein Cytoplasmic side. |
|
Protein Description | May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative (By similarity).. | |
Protein Sequence | MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGAKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Acetylation | IFHKYSGKEGDKHTL HHHHHCCCCCCCCCC | 53.21 | 22902405 | |
26 | Acetylation | YSGKEGDKHTLSKKE HCCCCCCCCCCCHHH | 49.71 | 22902405 | |
35 | Acetylation | TLSKKELKELIQKEL CCCHHHHHHHHHHHC | 52.12 | 22902405 | |
40 | Acetylation | ELKELIQKELTIGAK HHHHHHHHHCHHCHH | 47.93 | 22902405 | |
47 | Acetylation | KELTIGAKLQDAEIA HHCHHCHHHCHHHHH | 41.28 | 22902405 | |
47 | Succinylation | KELTIGAKLQDAEIA HHCHHCHHHCHHHHH | 41.28 | - | |
47 | Succinylation | KELTIGAKLQDAEIA HHCHHCHHHCHHHHH | 41.28 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10A6_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10A6_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A6_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S10A6_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...