UniProt ID | S10A1_MOUSE | |
---|---|---|
UniProt AC | P56565 | |
Protein Name | Protein S100-A1 | |
Gene Name | S100a1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 94 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.. | |
Protein Sequence | MGSELESAMETLINVFHAHSGQEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Ubiquitination | SGFLDVQKDADAVDK HCCCCHHCCHHHHHH | 55.52 | - | |
57 | Ubiquitination | KDADAVDKVMKELDE CCHHHHHHHHHHHHH | 37.32 | - | |
86 | S-nitrosocysteine | VAALTVACNNFFWET HHHHHHHHHHHHHCC | 3.58 | - | |
86 | S-nitrosylation | VAALTVACNNFFWET HHHHHHHHHHHHHCC | 3.58 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10A1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10A1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S10A1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...