| UniProt ID | S10A1_MOUSE | |
|---|---|---|
| UniProt AC | P56565 | |
| Protein Name | Protein S100-A1 | |
| Gene Name | S100a1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 94 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Probably acts as a Ca(2+) signal transducer. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change. This conformational change allows interaction of S1001A with specific target proteins, such as TPR-containing proteins, and the modulation of their activity.. | |
| Protein Sequence | MGSELESAMETLINVFHAHSGQEGDKYKLSKKELKDLLQTELSGFLDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 50 | Ubiquitination | SGFLDVQKDADAVDK HCCCCHHCCHHHHHH | 55.52 | - | |
| 57 | Ubiquitination | KDADAVDKVMKELDE CCHHHHHHHHHHHHH | 37.32 | - | |
| 86 | S-nitrosocysteine | VAALTVACNNFFWET HHHHHHHHHHHHHCC | 3.58 | - | |
| 86 | S-nitrosylation | VAALTVACNNFFWET HHHHHHHHHHHHHCC | 3.58 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10A1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10A1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S10A1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...