dbPTM

RTN4R_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RTN4R_MOUSE
UniProt AC	Q99PI8
Protein Name	Reticulon-4 receptor
Gene Name	Rtn4r
Organism	Mus musculus (Mouse).
Sequence Length	473
Subcellular Localization	Cell membrane Lipid-anchor, GPI-anchor . Membrane raft . Cell projection, dendrite . Cell projection, axon . Perikaryon . Detected along dendrites and axons, close to synapses, but clearly excluded from synapses.
Protein Description	Receptor for RTN4, OMG and MAG. [PubMed: 11201742]
Protein Sequence	MKRASSGGSRLLAWVLWLQAWRVATPCPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGPFRPIQTSQLTDEELLSLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDTPPGNGSGPRHINDSPFGTLPSSAEPPLTALRPGGSEPPGLPTTGPRRRPGCSRKNRTRSHCRLGQAGSGASGTGDAEGSGALPALACSLAPLGLALVLWTVLGPC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MKRASSGGSRLLA --CCCCCCHHHHHHH	46.30	28059163
82	N-linked_Glycosylation	ASFQSCRNLTILWLH HHHHHHCCCEEEEEC	45.95	29095159
179	N-linked_Glycosylation	NTFRDLGNLTHLFLH CCCHHHHHCCEEHHC	49.41	29095159
192	Phosphorylation	LHGNRIPSVPEHAFR HCCCCCCCCCHHHHC	48.18	24719451
372	N-linked_Glycosylation	PGDTPPGNGSGPRHI CCCCCCCCCCCCCCC	47.43	29095159
447	GPI-anchor	GTGDAEGSGALPALA CCCCCCCCCHHHHHH	16.64	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RTN4R_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RTN4R_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RTN4R_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RTN4R_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RTN4R_MOUSE

Related Literatures of Post-Translational Modification