| UniProt ID | RTL8B_HUMAN | |
|---|---|---|
| UniProt AC | Q17RB0 | |
| Protein Name | Retrotransposon Gag-like protein 8B {ECO:0000312|HGNC:HGNC:33156} | |
| Gene Name | RTL8B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 113 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Ubiquitination | EGRVQLMKALLARPL CHHHHHHHHHHHCCC | 23000965 | ||
| 85 | Sumoylation | QWVIPYIKKESPLLS HHHHHHHCCCCCCCH | - | ||
| 85 | Ubiquitination | QWVIPYIKKESPLLS HHHHHHHCCCCCCCH | 21963094 | ||
| 86 | Sumoylation | WVIPYIKKESPLLSD HHHHHHCCCCCCCHH | - | ||
| 86 | Ubiquitination | WVIPYIKKESPLLSD HHHHHHCCCCCCCHH | 22817900 | ||
| 94 | Phosphorylation | ESPLLSDYRGFLAEM CCCCCHHHHHHHHHH | 22817900 | ||
| 102 | Ubiquitination | RGFLAEMKRVFGWEE HHHHHHHHHHHCCCC | 21963094 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RTL8B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RTL8B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RTL8B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RTL8B_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...