RT34_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT34_MOUSE
• UniProt AC: Q9JIK9
• Protein Name: 28S ribosomal protein S34, mitochondrial
• Gene Name: Mrps34
• Organism: Mus musculus (Mouse).
• Sequence Length: 218
• Subcellular Localization: Mitochondrion .
• Protein Description: Required for mitochondrial translation, plays a role in maintaining the stability of the small ribosomal subunit and the 12S rRNA that are required for mitoribosome formation..
• Protein Sequence: MARKKVRPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRLLQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEDTAREIEQVMYHDWRLVPKHEEEAFTAFTAKPEDRLNSVPYPPLLRAMILAERQKNGDTSVQEPLLNLERTRMRPWDYPAKQETKGRAKGTPV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	QRNQPRDSQLYALDY HCCCCCCCCEEEECH	24.30	25162660
34	Phosphorylation	QPRDSQLYALDYETL CCCCCCEEEECHHHC	9.47	25162660
40	Phosphorylation	LYALDYETLTRPHSG EEEECHHHCCCCCCC	27.48	25162660
42	Phosphorylation	ALDYETLTRPHSGRR EECHHHCCCCCCCCC	49.96	25162660
156	Acetylation	AFTAFTAKPEDRLNS HCHHEECCHHHHCCC	45.97	23954790

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT34_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT34_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT34_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RT34_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.