RT26_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RT26_MOUSE
• UniProt AC: Q80ZS3
• Protein Name: 28S ribosomal protein S26, mitochondrial
• Gene Name: Mrps26
• Organism: Mus musculus (Mouse).
• Sequence Length: 200
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MLRALNRLAARPETRPPTPLLLPVRGRKTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARAGVLAERKAQQAITEHRELMAWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKSYNWAVTKEGQVVRN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	SKVGRVQTPPAVDPA CCCCCCCCCCCCCHH	28.51	22006019
93	Methylation	RAGVLAERKAQQAIT HHHHHHHHHHHHHHH	33.72	30988149
153	Acetylation	EQAWVQLKEQEVLKL HHHHHHHHHHHHHHH	40.02	23954790
159	Acetylation	LKEQEVLKLQEEAKN HHHHHHHHHHHHHHH	53.99	23576753
159	Succinylation	LKEQEVLKLQEEAKN HHHHHHHHHHHHHHH	53.99	23806337
165	Acetylation	LKLQEEAKNFITREN HHHHHHHHHCCCHHC	56.52	23201123
183	Phosphorylation	RIEEALDSPKSYNWA HHHHHHHCCCCCCEE	34.77	26824392
185	Acetylation	EEALDSPKSYNWAVT HHHHHCCCCCCEEEE	70.31	23954790
193	Acetylation	SYNWAVTKEGQVVRN CCCEEEECCCCCCCC	53.93	23576753
193	Succinylation	SYNWAVTKEGQVVRN CCCEEEECCCCCCCC	53.93	23954790

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RT26_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RT26_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RT26_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RT26_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.