UniProt ID | RT15_MOUSE | |
---|---|---|
UniProt AC | Q9DC71 | |
Protein Name | 28S ribosomal protein S15, mitochondrial | |
Gene Name | Mrps15 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 258 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MLRAAWRALSSVRAQAVTRAPVPALRGGSSASLLSARCGLQPPSLLRAARAYAAVQKPVQPKQDDEPPSSAFIKEYKDIIPNIEKVDDVVKRILSLEMASRKEKLKIKQEQLMNKIVENPEDSRTLEAQIIALTVRIRNYEEHMQKHRKDKAHKRHLLMSIDRRKKLLKILRQTNYDVFEKTCKELGVEYTLPPLHFQKVHRRFLAKKALCIRVYQEVQKLKKQKRALKAAAAAAKKEKNEGVPENPSNAVPEKTQVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | Acetylation | SAFIKEYKDIIPNIE HHHHHHHHHHCCCCH | 43.47 | 23954790 | |
85 | Acetylation | DIIPNIEKVDDVVKR HHCCCCHHHHHHHHH | 47.36 | 23954790 | |
85 | Succinylation | DIIPNIEKVDDVVKR HHCCCCHHHHHHHHH | 47.36 | 23954790 | |
220 | Acetylation | RVYQEVQKLKKQKRA HHHHHHHHHHHHHHH | 68.40 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RT15_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RT15_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RT15_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RT15_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...