UniProt ID | RSSA2_ARATH | |
---|---|---|
UniProt AC | Q8H173 | |
Protein Name | 40S ribosomal protein Sa-2 | |
Gene Name | RPSaB | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 280 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.. | |
Protein Sequence | MAANGVATAGRQVSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDPRTDHQPIKEGALGNIPTIAFCDTDSPMGFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTILAAQKWDVMVDLFFYREPEEAKQEGDEEAEVQADYGMVGGDQWTTAQISDAAWSGEVEQPISAAPAVGVTVAAGWEAASVPAAGWE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAANGVATA ------CCCCCCCCC | 15.05 | 22223895 | |
14 | Phosphorylation | ATAGRQVSEKEADIQ CCCCCCCCHHHHHHH | 34.31 | 22074104 | |
109 | Phosphorylation | NAIAGRHTPGTFTNQ CCCCCCCCCCCCHHH | 23.27 | 25561503 | |
234 (in isoform 2) | Phosphorylation | - | 16.72 | 23111157 | |
237 (in isoform 2) | Phosphorylation | - | 10.64 | 23111157 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSSA2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSSA2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSSA2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RSSA2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...