RSSA2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RSSA2_ARATH
• UniProt AC: Q8H173
• Protein Name: 40S ribosomal protein Sa-2
• Gene Name: RPSaB
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 280
• Subcellular Localization: Cytoplasm.
• Protein Description: Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits..
• Protein Sequence: MAANGVATAGRQVSEKEADIQMMLSADVHLGTKNCNYQMERYVFKRRDDGIYIINLGKTWDKLQMAARVIVAIENPKDIIVQSARPYGQRAVLKFAQYTGVNAIAGRHTPGTFTNQMQTSFSEPRLLILTDPRTDHQPIKEGALGNIPTIAFCDTDSPMGFVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTILAAQKWDVMVDLFFYREPEEAKQEGDEEAEVQADYGMVGGDQWTTAQISDAAWSGEVEQPISAAPAVGVTVAAGWEAASVPAAGWE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAANGVATA ------CCCCCCCCC	15.05	22223895
14	Phosphorylation	ATAGRQVSEKEADIQ CCCCCCCCHHHHHHH	34.31	22074104
109	Phosphorylation	NAIAGRHTPGTFTNQ CCCCCCCCCCCCHHH	23.27	25561503
234 (in isoform 2)	Phosphorylation	-	16.72	23111157
237 (in isoform 2)	Phosphorylation	-	10.64	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RSSA2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RSSA2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RSSA2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RSSA2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.