| UniProt ID | RSPH1_MOUSE | |
|---|---|---|
| UniProt AC | Q8VIG3 | |
| Protein Name | Radial spoke head 1 homolog | |
| Gene Name | Rsph1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 301 | |
| Subcellular Localization | Cytoplasm. Chromosome. Cell projection, cilium. Cytoplasmic in late spermatocytes, secondary spermatocytes and round spermatids. Gathered around metaphase chromosomes during meiotic divisions. | |
| Protein Description | The specific expression during male germ cell development and its characteristic localization suggest that it may play an important role in male meiosis. It is necessary for proper building of the axonemal central pair and radial spokes (By similarity).. | |
| Protein Sequence | MSDLGSEELEEEGENDLGEYEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFDIGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITELALWTPTLSEEQPPPEGQGQEEPQGLTGVGDPSEDIQAEGFEGELEPRGADEDVDTFRQESQENSYDIDQGNLNFDEEPSDLQD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSDLGSEEL ------CCCCCHHHH | 41.35 | 24759943 | |
| 6 | Phosphorylation | --MSDLGSEELEEEG --CCCCCHHHHHHHC | 34.88 | 25293948 | |
| 35 | Ubiquitination | GERHGHGKARLPNGD CCCCCCCCCCCCCCC | 25.34 | - | |
| 81 | Phosphorylation | NKKHGQGTFIYPDGS CCCCCCEEEECCCCC | 10.04 | - | |
| 166 | Ubiquitination | YQGKFMNKNPVGPGK CCCCCCCCCCCCCCE | 51.33 | - | |
| 189 | Phosphorylation | QHGEYRLTDTERGEE CCCEEECCCCCCCCH | 31.70 | 25293948 | |
| 191 | Phosphorylation | GEYRLTDTERGEEEE CEEECCCCCCCCHHH | 23.50 | 25293948 | |
| 273 | Phosphorylation | GADEDVDTFRQESQE CCCCCHHHHHHHHHH | 22.14 | 25293948 | |
| 278 | Phosphorylation | VDTFRQESQENSYDI HHHHHHHHHHCCCCC | 34.16 | 25293948 | |
| 282 | Phosphorylation | RQESQENSYDIDQGN HHHHHHCCCCCCCCC | 24.35 | 25293948 | |
| 283 | Phosphorylation | QESQENSYDIDQGNL HHHHHCCCCCCCCCC | 28.62 | 25293948 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RSPH1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RSPH1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RSPH1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RSPH1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
