| UniProt ID | RS9B_SCHPO | |
|---|---|---|
| UniProt AC | O59675 | |
| Protein Name | 40S ribosomal protein S9-B | |
| Gene Name | rps902 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 192 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | ||
| Protein Sequence | MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRVALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDESRMKLDYVLALRIEDFLERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDAQKHIDFALSSPYGGGRPGRCKRKRLRSQQEGGEGEEAEEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Phosphorylation | EIWRVALTLSKIRRA HHHHHHHHHHHHHHH | 21.17 | 25720772 | |
| 50 | Phosphorylation | WRVALTLSKIRRAAR HHHHHHHHHHHHHHH | 22.32 | 28889911 | |
| 89 | Phosphorylation | RLGILDESRMKLDYV HCCCCCHHHCCHHHH | 37.02 | 28889911 | |
| 145 | Phosphorylation | KQIVNVPSFVVRLDA CCEECCCCEEEEEEH | 26.79 | 25720772 | |
| 161 | Phosphorylation | KHIDFALSSPYGGGR HCCCEECCCCCCCCC | 26.32 | 28889911 | |
| 162 | Phosphorylation | HIDFALSSPYGGGRP CCCEECCCCCCCCCC | 24.00 | 25720772 | |
| 164 | Phosphorylation | DFALSSPYGGGRPGR CEECCCCCCCCCCCC | 30.28 | 28889911 | |
| 179 | Phosphorylation | CKRKRLRSQQEGGEG HHHHHHHHHCCCCCC | 40.59 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS9B_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS9B_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS9B_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YGNB_SCHPO | nap2 | physical | 26771498 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...