dbPTM

RS9B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS9B_SCHPO
UniProt AC	O59675
Protein Name	40S ribosomal protein S9-B
Gene Name	rps902
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	192
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRVALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDESRMKLDYVLALRIEDFLERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDAQKHIDFALSSPYGGGRPGRCKRKRLRSQQEGGEGEEAEEE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	Phosphorylation	EIWRVALTLSKIRRA HHHHHHHHHHHHHHH	21.17	25720772
50	Phosphorylation	WRVALTLSKIRRAAR HHHHHHHHHHHHHHH	22.32	28889911
89	Phosphorylation	RLGILDESRMKLDYV HCCCCCHHHCCHHHH	37.02	28889911
145	Phosphorylation	KQIVNVPSFVVRLDA CCEECCCCEEEEEEH	26.79	25720772
161	Phosphorylation	KHIDFALSSPYGGGR HCCCEECCCCCCCCC	26.32	28889911
162	Phosphorylation	HIDFALSSPYGGGRP CCCEECCCCCCCCCC	24.00	25720772
164	Phosphorylation	DFALSSPYGGGRPGR CEECCCCCCCCCCCC	30.28	28889911
179	Phosphorylation	CKRKRLRSQQEGGEG HHHHHHHHHCCCCCC	40.59	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS9B_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS9B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS9B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS9B_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-89 AND SER-179, AND MASSSPECTROMETRY.	18257517 [Abstract]