UniProt ID | RS9A_SCHPO | |
---|---|---|
UniProt AC | Q09757 | |
Protein Name | 40S ribosomal protein S9-A | |
Gene Name | rps901 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 191 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MPSAPRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRVALTLSKIRRAARELLTLDEKDPKRLFEGNAIIRRLVRLGILDETRMKLDYVLALRIEDFLERRLQTQVFKLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHIDFALSSPYGGGRPGRCKRKRLRSQEGGEGEEAEEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | EIWRVALTLSKIRRA HHHHHHHHHHHHHHH | 21.17 | 25720772 | |
50 | Phosphorylation | WRVALTLSKIRRAAR HHHHHHHHHHHHHHH | 22.32 | 28889911 | |
145 | Phosphorylation | KQIVNVPSFVVRLDT CCEECCCEEEEEECC | 26.79 | 25720772 | |
161 | Phosphorylation | KHIDFALSSPYGGGR CCEEEECCCCCCCCC | 26.32 | 28889911 | |
162 | Phosphorylation | HIDFALSSPYGGGRP CEEEECCCCCCCCCC | 24.00 | 25720772 | |
164 | Phosphorylation | DFALSSPYGGGRPGR EEECCCCCCCCCCCC | 30.28 | 28889911 | |
179 | Phosphorylation | CKRKRLRSQEGGEGE CCCHHHCCCCCCCCC | 36.86 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS9A_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS9A_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS9A_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YGNB_SCHPO | nap2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...