dbPTM

RS6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS6_CAEEL
UniProt AC	Q9NEN6
Protein Name	40S ribosomal protein S6
Gene Name	rps-6 {ECO:0000312\|EMBL:CAB81996.1}
Organism	Caenorhabditis elegans.
Sequence Length	246
Subcellular Localization
Protein Description	May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA (By similarity). Negatively regulates lifespan. [PubMed: 23879233]
Protein Sequence	MRLNFAYPATGLQKSFEVDEEKKLRLFFEKRMSQEVAIDALGDEWKGYVVRIGGGNDKQGFPMKQGILTNGRVRLLLKKGQSCYRERKNGERKRKSVRGCIVDANMSALSLVIVKKGDGEIEGLTDSVLPRKLGPKRASKIRKLFNLTKHDDVTKYVITHDKTFPDGVTKTIAPKIQRLITPARIARKKYLLRQKRNQKIKMRDDAAAYHKLLAKYSKEEHDAKIARRRSSASHHSESEVKKTSKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	PATGLQKSFEVDEEK CCCCCCCCEECCHHH	17.43	30078680
33	Phosphorylation	LFFEKRMSQEVAIDA HHHHHHCCCHHHHHH	27.50	28854356
107	Phosphorylation	CIVDANMSALSLVIV EEEECCCCEEEEEEE	26.35	30078680
110	Phosphorylation	DANMSALSLVIVKKG ECCCCEEEEEEEECC	21.95	30078680
230	Phosphorylation	AKIARRRSSASHHSE HHHHHHHHHHHCCCH	28.57	19060867
231	Phosphorylation	KIARRRSSASHHSES HHHHHHHHHHCCCHH	31.79	19060867
233	Phosphorylation	ARRRSSASHHSESEV HHHHHHHHCCCHHHH	24.55	19060867
236	Phosphorylation	RSSASHHSESEVKKT HHHHHCCCHHHHHHC	37.08	19060867
238	Phosphorylation	SASHHSESEVKKTSK HHHCCCHHHHHHCCC	51.18	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS6_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RS6_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS6_CAEEL

Related Literatures of Post-Translational Modification