RS6A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS6A_SCHPO
• UniProt AC: P05752
• Protein Name: 40S ribosomal protein S6-A
• Gene Name: rps601
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 239
• Protein Sequence: MKLNISYPANGTQKLIEIDDDRRLRVFMEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQGFPMFQGVLLPHRVRLLLRAGHPCYRPRRDGERKRKSVRGCIVGQDLAVLALAIIKQGEQDIPGLTDVTVPKRLGPKRASKIRRFFNLSKEDDVRQFVIRREVVPKKEGKKPYTKAPKIQRLVTPRTLQHKRHRFALKRRQAEKNREEAAEFAQLMAKRVAEAKQKREVVKARRASSLKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
148	Phosphorylation	IRRFFNLSKEDDVRQ HHHHHCCCCCCCHHH	34.79	28889911
235	Phosphorylation	VVKARRASSLKK--- HHHHHHHHHCCC---	34.10	24763107
236	Phosphorylation	VKARRASSLKK---- HHHHHHHHCCC----	43.13	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS6A_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS6A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS6A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS6B_SCHPO	rps602	genetic	20144990

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.