RS3A_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS3A_CAEEL
• UniProt AC: P48154
• Protein Name: 40S ribosomal protein S3a {ECO:0000255|HAMAP-Rule:MF_03122}
• Gene Name: rps-1 {ECO:0000255|HAMAP-Rule:MF_03122}
• Organism: Caenorhabditis elegans.
• Sequence Length: 257
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MAVGKNNNKMGKKGGKKKAVDPFSRKEWYDIKAPNMFNTRQVGKTLINRTQGTKIASEGLKGRVFEVSLGDLNNSEADFRKFKLIAEDVQGKNVLTNFHAMSMTHDKLCSIVKKWHTLIEANTAVKTTDGYTLRVFVIAFTKKSVNQVKKTSYTKTSKIRKIRSEMIGCIEKEVTGCDLKEVVSKLIPDSIGKDIEKTCSKLYPLQEVYIRKVKIIKRPKVDLGRLHDLHGDSITVGADGEKVDRPDDYEPPVQQEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
75	Phosphorylation	SLGDLNNSEADFRKF EECCCCCCHHHHHHE	32.84	28854356
102	Phosphorylation	LTNFHAMSMTHDKLC HHCHHHHHCCHHHHH	22.70	30078680
104	Phosphorylation	NFHAMSMTHDKLCSI CHHHHHCCHHHHHHH	21.44	30078680
203	Phosphorylation	EKTCSKLYPLQEVYI HHHHHHHCCCCEEEE	12.96	27067626
209	Phosphorylation	LYPLQEVYIRKVKII HCCCCEEEEEEEEEE	8.34	27067626
233	Phosphorylation	LHDLHGDSITVGADG CCCCCCCCEEECCCC	25.42	28854356
235	Phosphorylation	DLHGDSITVGADGEK CCCCCCEEECCCCCC	19.48	19530675

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS3A_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS3A_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS3A_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.