dbPTM

RS33_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS33_ARATH
UniProt AC	Q9FJA6
Protein Name	40S ribosomal protein S3-3
Gene Name	RPS3C
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	248
Subcellular Localization
Protein Description
Protein Sequence	MATQISKKRKFVADGVFYAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIRELTSLVQKRFKFPQDSVELYAEKVANRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYIDAAVRHVLLRQGVLGLKVKIMLDWDPKGKQGPMTPLPDVVIIHTPKEDDVYIAPAQVVTQAAFVPEAPLTTTDYPAMPVA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	Phosphorylation	AELNEVLTRELAEDG HHHHHHHHHHHHHCC	27.55	19880383
62	Ubiquitination	TQNVLGEKGRRIREL CCCCCCHHHHHHHHH	56.79	-
212	Phosphorylation	PDVVIIHTPKEDDVY CCEEEEECCCCCCEE	26.16	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS33_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS33_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS33_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RS33_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS33_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-212, AND MASSSPECTROMETRY.	19376835 [Abstract]
Ubiquitylation
Reference	PubMed
"Tandem affinity purification and mass spectrometric analysis ofubiquitylated proteins in Arabidopsis."; Saracco S.A., Hansson M., Scalf M., Walker J.M., Smith L.M.,Vierstra R.D.; Plant J. 59:344-358(2009). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-62, AND IDENTIFICATION BYMASS SPECTROMETRY.	19292762 [Abstract]