| UniProt ID | RS27L_MOUSE | |
|---|---|---|
| UniProt AC | Q6ZWY3 | |
| Protein Name | 40S ribosomal protein S27-like | |
| Gene Name | Rps27l {ECO:0000312|MGI:MGI:1915191} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 84 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | ARDLLHPSLEEEKKK HHHHCCCCHHHHHHH | 37.35 | 26824392 | |
| 16 | Acetylation | HPSLEEEKKKHKKKR CCCHHHHHHHHHHHH | 71.10 | 23954790 | |
| 16 | Ubiquitination | HPSLEEEKKKHKKKR CCCHHHHHHHHHHHH | 71.10 | 22790023 | |
| 27 | Phosphorylation | KKKRLVQSPNSYFMD HHHHHCCCCCCCCCC | 20.69 | 26824392 | |
| 30 | Phosphorylation | RLVQSPNSYFMDVKC HHCCCCCCCCCCCCC | 24.11 | 23984901 | |
| 31 | Phosphorylation | LVQSPNSYFMDVKCP HCCCCCCCCCCCCCC | 15.01 | 25521595 | |
| 77 | S-nitrosocysteine | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | - | |
| 77 | Glutathionylation | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | 24333276 | |
| 77 | S-nitrosylation | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | 20925432 | |
| 77 | S-palmitoylation | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | 26165157 | |
| 78 | Phosphorylation | ARLTEGCSFRRKQH- EECCCCCCCCCCCC- | 32.42 | 26824392 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS27L_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS27L_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS27L_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RS27L_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...