UniProt ID | RS27L_MOUSE | |
---|---|---|
UniProt AC | Q6ZWY3 | |
Protein Name | 40S ribosomal protein S27-like | |
Gene Name | Rps27l {ECO:0000312|MGI:MGI:1915191} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 84 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | ARDLLHPSLEEEKKK HHHHCCCCHHHHHHH | 37.35 | 26824392 | |
16 | Acetylation | HPSLEEEKKKHKKKR CCCHHHHHHHHHHHH | 71.10 | 23954790 | |
16 | Ubiquitination | HPSLEEEKKKHKKKR CCCHHHHHHHHHHHH | 71.10 | 22790023 | |
27 | Phosphorylation | KKKRLVQSPNSYFMD HHHHHCCCCCCCCCC | 20.69 | 26824392 | |
30 | Phosphorylation | RLVQSPNSYFMDVKC HHCCCCCCCCCCCCC | 24.11 | 23984901 | |
31 | Phosphorylation | LVQSPNSYFMDVKCP HCCCCCCCCCCCCCC | 15.01 | 25521595 | |
77 | S-nitrosocysteine | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | - | |
77 | Glutathionylation | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | 24333276 | |
77 | S-nitrosylation | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | 20925432 | |
77 | S-palmitoylation | KARLTEGCSFRRKQH CEECCCCCCCCCCCC | 2.57 | 26165157 | |
78 | Phosphorylation | ARLTEGCSFRRKQH- EECCCCCCCCCCCC- | 32.42 | 26824392 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS27L_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS27L_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS27L_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS27L_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...