dbPTM

RS24B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS24B_SCHPO
UniProt AC	O59865
Protein Name	40S ribosomal protein S24-B
Gene Name	rps2402
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	134
Subcellular Localization
Protein Description
Protein Sequence	MSEAVTIRTRKFMTNRLLQRKQMVVDILHPGKANLSKNEIREKLAQMYKTDSECVQAFGLRTHFGGGRSTGFALIYDSTESMKKFEPHYRLVRVGQAEPIQKVARQQRKQRKNRGKKVFGTGKRLAKRKSKQQD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSEAVTIRT ------CCCCCHHHH	33.97	-
69	Phosphorylation	THFGGGRSTGFALIY EECCCCCCCEEEEEE	35.84	25720772
70	Phosphorylation	HFGGGRSTGFALIYD ECCCCCCCEEEEEEE	34.65	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS24B_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS24B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS24B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS24B_SCHPO

Related Literatures of Post-Translational Modification