UniProt ID | RS21_SCHPO | |
---|---|---|
UniProt AC | P05764 | |
Protein Name | 40S ribosomal protein S21 | |
Gene Name | rps21 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 87 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability.. | |
Protein Sequence | MENEAGQLVDLYVPRKCSATNRIIQAKDHASVQINVCAVDAEGRQIPGEKTTYAISGFVRSKGESDDCINRLTTQDGLLEGVWSYQR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MENEAGQL -------CCCCCCCE | 12.92 | 3910104 | |
18 | Phosphorylation | LYVPRKCSATNRIIQ EEECCCCCCCCCEEE | 40.96 | 24763107 | |
51 | Phosphorylation | RQIPGEKTTYAISGF CCCCCCCEEEEEEEE | 22.27 | 25720772 | |
61 | Phosphorylation | AISGFVRSKGESDDC EEEEEEECCCCCCHH | 39.45 | 29996109 | |
84 | Phosphorylation | GLLEGVWSYQR---- CHHCCCCCCCC---- | 14.69 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS21_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS21_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS21_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RSSA1_SCHPO | rps001 | physical | 14623272 | |
RSSA2_SCHPO | rps002 | physical | 14623272 | |
RSSA1_SCHPO | rps001 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...