RS21_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS21_SCHPO
• UniProt AC: P05764
• Protein Name: 40S ribosomal protein S21
• Gene Name: rps21
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 87
• Subcellular Localization: Cytoplasm .
• Protein Description: Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability..
• Protein Sequence: MENEAGQLVDLYVPRKCSATNRIIQAKDHASVQINVCAVDAEGRQIPGEKTTYAISGFVRSKGESDDCINRLTTQDGLLEGVWSYQR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MENEAGQL -------CCCCCCCE	12.92	3910104
18	Phosphorylation	LYVPRKCSATNRIIQ EEECCCCCCCCCEEE	40.96	24763107
51	Phosphorylation	RQIPGEKTTYAISGF CCCCCCCEEEEEEEE	22.27	25720772
61	Phosphorylation	AISGFVRSKGESDDC EEEEEEECCCCCCHH	39.45	29996109
84	Phosphorylation	GLLEGVWSYQR---- CHHCCCCCCCC----	14.69	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS21_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS21_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS21_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RSSA1_SCHPO	rps001	physical	14623272
RSSA2_SCHPO	rps002	physical	14623272
RSSA1_SCHPO	rps001	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.