| UniProt ID | RS21_RAT | |
|---|---|---|
| UniProt AC | P05765 | |
| Protein Name | 40S ribosomal protein S21 | |
| Gene Name | Rps21 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 83 | |
| Subcellular Localization | Cytoplasm, cytosol . Cytoplasm . Rough endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity). | |
| Protein Description | ||
| Protein Sequence | MQNDAGEFVDLYVPRKCSASNRIIAAKDHASIQMNVAEVDRSTGRFNGQFKTYGICGAIRRMGESDDSILRLAKADGIVSKNF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MQNDAGEF -------CCCCCCCE | 8.29 | 3910104 | |
| 27 | Acetylation | SNRIIAAKDHASIQM CCCEEEECCCCEEEE | 40.81 | 22902405 | |
| 42 | Phosphorylation | NVAEVDRSTGRFNGQ EEEEECCCCCCCCCE | 30.65 | 25575281 | |
| 43 | Phosphorylation | VAEVDRSTGRFNGQF EEEECCCCCCCCCEE | 33.02 | 25575281 | |
| 51 | Acetylation | GRFNGQFKTYGICGA CCCCCEEEECEEHHH | 32.71 | 22902405 | |
| 65 | Phosphorylation | AIRRMGESDDSILRL HHHHCCCCCHHHHHH | 40.77 | 27097102 | |
| 68 | Phosphorylation | RMGESDDSILRLAKA HCCCCCHHHHHHHHH | 28.63 | 25575281 | |
| 74 | Acetylation | DSILRLAKADGIVSK HHHHHHHHHCCCCCC | 52.15 | 22902405 | |
| 81 | Acetylation | KADGIVSKNF----- HHCCCCCCCC----- | 52.02 | 22902405 | |
| 81 | Ubiquitination | KADGIVSKNF----- HHCCCCCCCC----- | 52.02 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS21_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS21_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS21_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RS21_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...