RS21_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS21_CAEEL
• UniProt AC: P49197
• Protein Name: 40S ribosomal protein S21
• Gene Name: rps-21
• Organism: Caenorhabditis elegans.
• Sequence Length: 88
• Subcellular Localization: Cytoplasm, cytosol . Cytoplasm . Rough endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity).
• Protein Sequence: MQNDAGQTVELYVPRKCSSSNRIIGPKDHASVQIDFVDVDPETGRMIPGKSTRYAICGAIRRMGESDDAILRLAQKDGLVPRDDVKSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
66	Phosphorylation	AIRRMGESDDAILRL HHHHHCCCHHHHHHH	34.75	30078680
87	Phosphorylation	VPRDDVKSN------ CCHHHCCCC------	47.85	26392051

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS21_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS21_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS21_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RSSA_CAEEL	rps-0	physical	18692475

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.