UniProt ID | RS21_ARATH | |
---|---|---|
UniProt AC | Q8L8Y0 | |
Protein Name | 40S ribosomal protein S2-1 | |
Gene Name | RPS2A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 284 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAERGGEGGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRGRRGGRASEETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATKVITEGEDQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
195 | Phosphorylation | MVPAPRGSGIVAARV EEECCCCCCEEEEEC | 26.99 | 28011693 | |
255 | Phosphorylation | FWKETRFSRSPYQEH HHHHHCCCCCCCHHH | 28.67 | 23776212 | |
257 | Phosphorylation | KETRFSRSPYQEHTD HHHCCCCCCCHHHHC | 27.10 | 30291188 | |
259 | Phosphorylation | TRFSRSPYQEHTDFL HCCCCCCCHHHHCHH | 27.99 | 23776212 | |
263 | Phosphorylation | RSPYQEHTDFLSTKA CCCCHHHHCHHCCCC | 27.91 | 23776212 | |
267 | Phosphorylation | QEHTDFLSTKAVSAT HHHHCHHCCCCCCEE | 28.05 | 23776212 | |
272 | Phosphorylation | FLSTKAVSATKVITE HHCCCCCCEEEEEEC | 34.77 | 26476206 | |
278 | Phosphorylation | VSATKVITEGEDQA- CCEEEEEECCCCCC- | 40.71 | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS21_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS21_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS21_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS21_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...