RS21_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS21_ARATH
• UniProt AC: Q8L8Y0
• Protein Name: 40S ribosomal protein S2-1
• Gene Name: RPS2A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 284
• Protein Sequence: MAERGGEGGAERGGDRGDFGRGFGGGRGGGRGRDRGPRGRGRRGGRASEETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDDVFTSSRGSTKTLGNFVKATFDCLQKTYGFLTPEFWKETRFSRSPYQEHTDFLSTKAVSATKVITEGEDQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
195	Phosphorylation	MVPAPRGSGIVAARV EEECCCCCCEEEEEC	26.99	28011693
255	Phosphorylation	FWKETRFSRSPYQEH HHHHHCCCCCCCHHH	28.67	23776212
257	Phosphorylation	KETRFSRSPYQEHTD HHHCCCCCCCHHHHC	27.10	30291188
259	Phosphorylation	TRFSRSPYQEHTDFL HCCCCCCCHHHHCHH	27.99	23776212
263	Phosphorylation	RSPYQEHTDFLSTKA CCCCHHHHCHHCCCC	27.91	23776212
267	Phosphorylation	QEHTDFLSTKAVSAT HHHHCHHCCCCCCEE	28.05	23776212
272	Phosphorylation	FLSTKAVSATKVITE HHCCCCCCEEEEEEC	34.77	26476206
278	Phosphorylation	VSATKVITEGEDQA- CCEEEEEECCCCCC-	40.71	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS21_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS21_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS21_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RS21_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.