UniProt ID | RS19A_SCHPO | |
---|---|---|
UniProt AC | P58234 | |
Protein Name | 40S ribosomal protein S19-A | |
Gene Name | rps1901 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 144 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAGVSVKDVDAQKFITAYAAFLKRSGKMTTPQWIDIVKTGTHKELAPYDPDWYYVRAAAIARHIYLRKQVGVGRLCKVYGGSVNRGMRPSHHRDGSGSVQRKVVQSLEKIGVLEKSDNGGRRISQQGQRDLDRIAYSLLEEESE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
82 | Phosphorylation | LCKVYGGSVNRGMRP HHHHHCCCCCCCCCC | 16.32 | 25720772 | |
116 | Phosphorylation | KIGVLEKSDNGGRRI HHCCEEECCCCCCCC | 27.25 | 25720772 | |
136 | Phosphorylation | RDLDRIAYSLLEEES HHHHHHHHHHHHHHC | 9.47 | 25720772 | |
143 | Phosphorylation | YSLLEEESE------ HHHHHHHCC------ | 52.46 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS19A_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS19A_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS19A_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS19A_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...