UniProt ID | RS17_RAT | |
---|---|---|
UniProt AC | P04644 | |
Protein Name | 40S ribosomal protein S17 | |
Gene Name | Rps17 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 135 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKNLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
19 | Acetylation | AARVIIEKYYTRLGN HHHHHHHHHHHHHCC | 32.90 | 22902405 | |
19 | Succinylation | AARVIIEKYYTRLGN HHHHHHHHHHHHHCC | 32.90 | - | |
19 | Succinylation | AARVIIEKYYTRLGN HHHHHHHHHHHHHCC | 32.90 | - | |
59 | Acetylation | GYVTHLMKRIQRGPV HHHHHHHHHHHCCCC | 53.35 | 72603585 | |
70 | Phosphorylation | RGPVRGISIKLQEEE CCCCCCEEEECCHHH | 19.25 | 23984901 | |
103 | Acetylation | IEVDPDTKEMLKLLD EEECCCHHHHHHHHH | 48.81 | 22902405 | |
113 | Phosphorylation | LKLLDFGSLSNLQVT HHHHHHHCCCCCEEC | 28.72 | 23712012 | |
115 | Phosphorylation | LLDFGSLSNLQVTQP HHHHHCCCCCEECCC | 36.87 | 27097102 | |
120 | Phosphorylation | SLSNLQVTQPTVGMN CCCCCEECCCCCCCC | 18.83 | 28551015 | |
123 | Phosphorylation | NLQVTQPTVGMNFKT CCEECCCCCCCCCCC | 21.63 | 28689409 | |
130 | Phosphorylation | TVGMNFKTPRGAV-- CCCCCCCCCCCCC-- | 17.68 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS17_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS17_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS17_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS17_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...