| UniProt ID | RS17_RAT | |
|---|---|---|
| UniProt AC | P04644 | |
| Protein Name | 40S ribosomal protein S17 | |
| Gene Name | Rps17 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 135 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKNLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNFKTPRGAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Acetylation | AARVIIEKYYTRLGN HHHHHHHHHHHHHCC | 32.90 | 22902405 | |
| 19 | Succinylation | AARVIIEKYYTRLGN HHHHHHHHHHHHHCC | 32.90 | - | |
| 19 | Succinylation | AARVIIEKYYTRLGN HHHHHHHHHHHHHCC | 32.90 | - | |
| 59 | Acetylation | GYVTHLMKRIQRGPV HHHHHHHHHHHCCCC | 53.35 | 72603585 | |
| 70 | Phosphorylation | RGPVRGISIKLQEEE CCCCCCEEEECCHHH | 19.25 | 23984901 | |
| 103 | Acetylation | IEVDPDTKEMLKLLD EEECCCHHHHHHHHH | 48.81 | 22902405 | |
| 113 | Phosphorylation | LKLLDFGSLSNLQVT HHHHHHHCCCCCEEC | 28.72 | 23712012 | |
| 115 | Phosphorylation | LLDFGSLSNLQVTQP HHHHHCCCCCEECCC | 36.87 | 27097102 | |
| 120 | Phosphorylation | SLSNLQVTQPTVGMN CCCCCEECCCCCCCC | 18.83 | 28551015 | |
| 123 | Phosphorylation | NLQVTQPTVGMNFKT CCEECCCCCCCCCCC | 21.63 | 28689409 | |
| 130 | Phosphorylation | TVGMNFKTPRGAV-- CCCCCCCCCCCCC-- | 17.68 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS17_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS17_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS17_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RS17_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...