RS151_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS151_ARATH
• UniProt AC: Q08112
• Protein Name: 40S ribosomal protein S15-1
• Gene Name: RPS15A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 152
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MADVEPEVAAAGVPKKRTFKKFAFKGVDLDALLDMSTDDLVKLFSSRIRRRFSRGLTRKPMALIKKLRKAKREAPQGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGVGATHSSRFIPLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADVEPEVA ------CCCCCHHHH	29.56	17934214
35	Sulfoxidation	DLDALLDMSTDDLVK CHHHHHCCCHHHHHH	4.72	23289948
36	Phosphorylation	LDALLDMSTDDLVKL HHHHHCCCHHHHHHH	28.49	30291188
37	Phosphorylation	DALLDMSTDDLVKLF HHHHCCCHHHHHHHH	27.22	23776212
145	Phosphorylation	PGVGATHSSRFIPLK CCCCCCCCCCCCCCC	20.89	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS151_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS151_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS151_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RS151_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.