dbPTM

RS13_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS13_SCHPO
UniProt AC	P28189
Protein Name	40S ribosomal protein S13
Gene Name	rps13
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	151
Subcellular Localization
Protein Description
Protein Sequence	MGRMHSKGKGIASSALPYVRSPPAWCKADADSVVEQILKFSKKGMSPSQIGVTLRDSHGIPQVRFITGQKIMRILKANGLAPELPEDLYNLIKKAVSVRKHLERNRKDKDSKFRLILIESRIHRLARYYRKVGALPPTWKYESATASALVA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	SKGKGIASSALPYVR CCCCCCCCCCCCCCC	17.77	29996109
14	Phosphorylation	KGKGIASSALPYVRS CCCCCCCCCCCCCCC	25.46	28889911
18	Phosphorylation	IASSALPYVRSPPAW CCCCCCCCCCCCCCH	14.89	29996109
21	Phosphorylation	SALPYVRSPPAWCKA CCCCCCCCCCCHHCC	25.78	28889911
32	Phosphorylation	WCKADADSVVEQILK HHCCCHHHHHHHHHH	29.77	28889911
46	Phosphorylation	KFSKKGMSPSQIGVT HHHHCCCCHHHCCCC	30.02	28889911
48	Phosphorylation	SKKGMSPSQIGVTLR HHCCCCHHHCCCCCC	27.42	28889911
53	Phosphorylation	SPSQIGVTLRDSHGI CHHHCCCCCCCCCCC	15.74	28889911
89	Phosphorylation	PELPEDLYNLIKKAV CCCCHHHHHHHHHHH	21.90	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS13_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS13_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS13_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS13_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 AND SER-32, AND MASSSPECTROMETRY.	18257517 [Abstract]