UniProt ID | RS12_CAEEL | |
---|---|---|
UniProt AC | P49196 | |
Protein Name | 40S ribosomal protein S12 | |
Gene Name | rps-12 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 140 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSDAGGDVQVAPAAVAQGPMDKEGALRAVLRAAHHADGLAKGLHETCKALDKREAHFCVLAENCDEPQYVKLVETLCAEHQIPLIKVADKKIIGEYCGLCKYDKEGKARKVVGCSSAVVTNWGNEEQGRAILTDYFASKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDAGGDVQ ------CCCCCCCCE | 35.85 | 28854356 | |
96 | Phosphorylation | DKKIIGEYCGLCKYD CCEEHHHHHCCCCCC | 6.13 | 27067626 | |
135 | Phosphorylation | GRAILTDYFASKN-- HHHHHHHHHCCCC-- | 8.87 | 27067626 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS12_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS12_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS12_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS12_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...