UniProt ID | RS122_ARATH | |
---|---|---|
UniProt AC | Q9SKZ3 | |
Protein Name | 40S ribosomal protein S12-2 | |
Gene Name | RPS12C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 144 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSGDEAVAAPVVPPVAEAAVIPEDMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALCADHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHLDSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGDEAVAA ------CCCCCCCCC | 55.76 | 22223895 | |
2 | Phosphorylation | ------MSGDEAVAA ------CCCCCCCCC | 55.76 | 27531888 | |
86 | Phosphorylation | KALCADHSIKLLTVP HHHHCCCCCEEEEEC | 23.20 | 25561503 | |
91 | Phosphorylation | DHSIKLLTVPSAKTL CCCCEEEEECCCCCH | 40.58 | 25561503 | |
94 | Phosphorylation | IKLLTVPSAKTLGEW CEEEEECCCCCHHHH | 37.75 | 30589143 | |
109 | Phosphorylation | AGLCKIDSEGNARKV CCCEEECCCCCCEEE | 51.37 | 29654922 | |
131 | Phosphorylation | IKDFGEETTALNIVK EEECCCCHHHHHHHH | 17.05 | 23820729 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS122_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS122_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS122_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS122_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...