RS122_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS122_ARATH
• UniProt AC: Q9SKZ3
• Protein Name: 40S ribosomal protein S12-2
• Gene Name: RPS12C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 144
• Protein Sequence: MSGDEAVAAPVVPPVAEAAVIPEDMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAEDCNQPDYVKLVKALCADHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTALNIVKKHLDSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGDEAVAA ------CCCCCCCCC	55.76	22223895
2	Phosphorylation	------MSGDEAVAA ------CCCCCCCCC	55.76	27531888
86	Phosphorylation	KALCADHSIKLLTVP HHHHCCCCCEEEEEC	23.20	25561503
91	Phosphorylation	DHSIKLLTVPSAKTL CCCCEEEEECCCCCH	40.58	25561503
94	Phosphorylation	IKLLTVPSAKTLGEW CEEEEECCCCCHHHH	37.75	30589143
109	Phosphorylation	AGLCKIDSEGNARKV CCCEEECCCCCCEEE	51.37	29654922
131	Phosphorylation	IKDFGEETTALNIVK EEECCCCHHHHHHHH	17.05	23820729

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS122_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS122_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS122_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RS122_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.