RS121_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS121_ARATH
• UniProt AC: Q9S9P1
• Protein Name: 40S ribosomal protein S12-1
• Gene Name: RPS12A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 144
• Protein Sequence: MSGDEAAPVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLAEDCNQPDYVKLVKALCADHEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKDFGEETTALSIVNKHIASQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGDEAAPV ------CCCCCCCCE	55.76	-
2	Phosphorylation	------MSGDEAAPV ------CCCCCCCCE	55.76	24924143
91	Phosphorylation	DHEVRLLTVPSAKTL CCCEEEEEECCCCCH	34.66	25561503
94	Phosphorylation	VRLLTVPSAKTLGEW EEEEEECCCCCHHHH	37.75	30589143
109	Phosphorylation	AGLCKIDSEGNARKV CCCEEECCCCCCEEE	51.37	29654922
131	Phosphorylation	VKDFGEETTALSIVN EEECCCCCHHHHHHH	17.05	27029354
132	Phosphorylation	KDFGEETTALSIVNK EECCCCCHHHHHHHH	28.96	27029354
135	Phosphorylation	GEETTALSIVNKHIA CCCCHHHHHHHHHHH	23.25	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS121_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS121_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS121_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RS121_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.