UniProt ID | RS121_ARATH | |
---|---|---|
UniProt AC | Q9S9P1 | |
Protein Name | 40S ribosomal protein S12-1 | |
Gene Name | RPS12A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 144 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSGDEAAPVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLAEDCNQPDYVKLVKALCADHEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKDFGEETTALSIVNKHIASQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSGDEAAPV ------CCCCCCCCE | 55.76 | - | |
2 | Phosphorylation | ------MSGDEAAPV ------CCCCCCCCE | 55.76 | 24924143 | |
91 | Phosphorylation | DHEVRLLTVPSAKTL CCCEEEEEECCCCCH | 34.66 | 25561503 | |
94 | Phosphorylation | VRLLTVPSAKTLGEW EEEEEECCCCCHHHH | 37.75 | 30589143 | |
109 | Phosphorylation | AGLCKIDSEGNARKV CCCEEECCCCCCEEE | 51.37 | 29654922 | |
131 | Phosphorylation | VKDFGEETTALSIVN EEECCCCCHHHHHHH | 17.05 | 27029354 | |
132 | Phosphorylation | KDFGEETTALSIVNK EECCCCCHHHHHHHH | 28.96 | 27029354 | |
135 | Phosphorylation | GEETTALSIVNKHIA CCCCHHHHHHHHHHH | 23.25 | 23111157 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS121_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS121_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS121_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS121_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...